SCOPe 2.05: Domain d2yxqb1: 2yxq B:2-66

Lineage for d2yxqb1 (2yxq B:2-66)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
   not a true fold

4. Superfamily f.23.28: Preprotein translocase SecE subunit [103456] (1 family)

5. Family f.23.28.1: Preprotein translocase SecE subunit [103457] (1 protein)

6. Protein Preprotein translocase SecE subunit [103458] (3 species)

7. Species Methanococcus jannaschii [TaxId:2190] [103459] (4 PDB entries)

8. Domain d2yxqb1: 2yxq B:2-66 [153825]
   Other proteins in same PDB: d2yxqc1
   automatically matched to d1rhzb_

Details for d2yxqb1

PDB Entry: 2yxq, 3.5 Å

PDB Description: The plug domain of the SecY protein stablizes the closed state of the translocation channel and maintains a membrane seal

PDB Compounds: (B:) Preprotein translocase subunit secE

SCOPe Domain Sequences for d2yxqb1:

Sequence; same for both SEQRES and ATOM records:

>d2yxqb1 f.23.28.1 (B:2-66) Preprotein translocase SecE subunit {Methanococcus jannaschii [TaxId: 2190]}
tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyi
kgilk

Timeline for d2yxqb1:

• d2yxqb1 first appeared in SCOP 1.75
  
• d2yxqb1 appears in SCOPe 2.04
  
• d2yxqb1 appears in SCOPe 2.06
  
• d2yxqb1 appears in the current release, SCOPe 2.08