Lineage for d1g0aa_ (1g0a A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 275747Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 275852Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 275873Species Cow (Bos taurus) [TaxId:9913] [46490] (5 PDB entries)
  8. 275876Domain d1g0aa_: 1g0a A: [15382]
    Other proteins in same PDB: d1g0ab_, d1g0ad_

Details for d1g0aa_

PDB Entry: 1g0a (more details), 2.04 Å

PDB Description: carbonmonoxy liganded bovine hemoglobin ph 8.5

SCOP Domain Sequences for d1g0aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0aa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cow (Bos taurus)}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

SCOP Domain Coordinates for d1g0aa_:

Click to download the PDB-style file with coordinates for d1g0aa_.
(The format of our PDB-style files is described here.)

Timeline for d1g0aa_: