SCOP 1.75: Domain d2ywqd1: 2ywq D:1-95

Lineage for d2ywqd1 (2ywq D:1-95)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily)
   beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest

4. Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (1 family)

5. Family d.204.1.1: Ribosome binding protein Y (YfiA homologue) [69755] (1 protein)

6. Protein Ribosome binding protein Y (YfiA homologue) [69756] (3 species)
   Ribosome associated factor; cold-shock response protein

7. Species Thermus thermophilus [TaxId:274] [160457] (1 PDB entry)
   Uniprot Q5SIS0 1-95

8. Domain d2ywqd1: 2ywq D:1-95 [153815]
   automatically matched to 2YWQ A:1-95

Details for d2ywqd1

PDB Entry: 2ywq, 2.64 Å

PDB Description: Crystal structure of Thermus thermophilus Protein Y N-terminal domain

PDB Compounds: (D:) Ribosomal subunit interface protein

SCOP Domain Sequences for d2ywqd1:

Sequence, based on SEQRES records:

>d2ywqd1 d.204.1.1 (D:1-95) Ribosome binding protein Y (YfiA homologue) {Thermus thermophilus [TaxId: 274]}
mniykligrnleitdairdyvekklarldryqdgelmakvvlslagsphvekkaraeiqv
dlpgglvrveeedadlyaaidravdrletqvkrfr

Sequence, based on observed residues (ATOM records):

>d2ywqd1 d.204.1.1 (D:1-95) Ribosome binding protein Y (YfiA homologue) {Thermus thermophilus [TaxId: 274]}
mniykligrnleitdairdyvekklarldryqdgelmakvvlslagkaraeiqvdlpggl
vrveeedadlyaaidravdrletqvkrfr

Timeline for d2ywqd1:

• d2ywqd1 is new in SCOP 1.75
  
• d2ywqd1 is called d2ywqd_ in SCOPe 2.01
  
• d2ywqd1 appears in the current release, SCOPe 2.08, called d2ywqd_