Lineage for d2ywqc_ (2ywq C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1050612Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily)
    beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest
  4. 1050613Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (1 family) (S)
  5. 1050614Family d.204.1.1: Ribosome binding protein Y (YfiA homologue) [69755] (1 protein)
  6. 1050615Protein Ribosome binding protein Y (YfiA homologue) [69756] (3 species)
    Ribosome associated factor; cold-shock response protein
  7. 1050621Species Thermus thermophilus [TaxId:274] [160457] (1 PDB entry)
    Uniprot Q5SIS0 1-95
  8. 1050624Domain d2ywqc_: 2ywq C: [153814]
    automated match to d2ywqa1

Details for d2ywqc_

PDB Entry: 2ywq (more details), 2.64 Å

PDB Description: Crystal structure of Thermus thermophilus Protein Y N-terminal domain
PDB Compounds: (C:) Ribosomal subunit interface protein

SCOPe Domain Sequences for d2ywqc_:

Sequence, based on SEQRES records: (download)

>d2ywqc_ d.204.1.1 (C:) Ribosome binding protein Y (YfiA homologue) {Thermus thermophilus [TaxId: 274]}
mniykligrnleitdairdyvekklarldryqdgelmakvvlslagsphvekkaraeiqv
dlpgglvrveeedadlyaaidravdrletqvkrfr

Sequence, based on observed residues (ATOM records): (download)

>d2ywqc_ d.204.1.1 (C:) Ribosome binding protein Y (YfiA homologue) {Thermus thermophilus [TaxId: 274]}
mniykligrnleitdairdyvekklarldryqdgelmakvvlslagkkaraeiqvdlpgg
lvrveeedadlyaaidravdrletqvkrfr

SCOPe Domain Coordinates for d2ywqc_:

Click to download the PDB-style file with coordinates for d2ywqc_.
(The format of our PDB-style files is described here.)

Timeline for d2ywqc_: