Lineage for d2ywqc1 (2ywq C:1-95)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 880111Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily)
    beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest
  4. 880112Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (1 family) (S)
  5. 880113Family d.204.1.1: Ribosome binding protein Y (YfiA homologue) [69755] (1 protein)
  6. 880114Protein Ribosome binding protein Y (YfiA homologue) [69756] (3 species)
    Ribosome associated factor; cold-shock response protein
  7. 880120Species Thermus thermophilus [TaxId:274] [160457] (1 PDB entry)
    Uniprot Q5SIS0 1-95
  8. 880123Domain d2ywqc1: 2ywq C:1-95 [153814]
    automatically matched to 2YWQ A:1-95

Details for d2ywqc1

PDB Entry: 2ywq (more details), 2.64 Å

PDB Description: Crystal structure of Thermus thermophilus Protein Y N-terminal domain
PDB Compounds: (C:) Ribosomal subunit interface protein

SCOP Domain Sequences for d2ywqc1:

Sequence, based on SEQRES records: (download)

>d2ywqc1 d.204.1.1 (C:1-95) Ribosome binding protein Y (YfiA homologue) {Thermus thermophilus [TaxId: 274]}
mniykligrnleitdairdyvekklarldryqdgelmakvvlslagsphvekkaraeiqv
dlpgglvrveeedadlyaaidravdrletqvkrfr

Sequence, based on observed residues (ATOM records): (download)

>d2ywqc1 d.204.1.1 (C:1-95) Ribosome binding protein Y (YfiA homologue) {Thermus thermophilus [TaxId: 274]}
mniykligrnleitdairdyvekklarldryqdgelmakvvlslagkkaraeiqvdlpgg
lvrveeedadlyaaidravdrletqvkrfr

SCOP Domain Coordinates for d2ywqc1:

Click to download the PDB-style file with coordinates for d2ywqc1.
(The format of our PDB-style files is described here.)

Timeline for d2ywqc1: