SCOPe 2.08: Domain d2ywqb_: 2ywq B:

Lineage for d2ywqb_ (2ywq B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily)
   beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest

4. Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families)
   automatically mapped to Pfam PF02482

5. Family d.204.1.1: Ribosome binding protein Y (YfiA homologue) [69755] (2 proteins)

6. Protein Ribosome binding protein Y (YfiA homologue) [69756] (3 species)
   Ribosome associated factor; cold-shock response protein

7. Species Thermus thermophilus [TaxId:274] [160457] (1 PDB entry)
   Uniprot Q5SIS0 1-95

8. Domain d2ywqb_: 2ywq B: [153813]
   automated match to d2ywqa1

Details for d2ywqb_

PDB Entry: 2ywq, 2.64 Å

PDB Description: Crystal structure of Thermus thermophilus Protein Y N-terminal domain

PDB Compounds: (B:) Ribosomal subunit interface protein

SCOPe Domain Sequences for d2ywqb_:

Sequence, based on SEQRES records:

>d2ywqb_ d.204.1.1 (B:) Ribosome binding protein Y (YfiA homologue) {Thermus thermophilus [TaxId: 274]}
mniykligrnleitdairdyvekklarldryqdgelmakvvlslagsphvekkaraeiqv
dlpgglvrveeedadlyaaidravdrletqvkrfr

Sequence, based on observed residues (ATOM records):

>d2ywqb_ d.204.1.1 (B:) Ribosome binding protein Y (YfiA homologue) {Thermus thermophilus [TaxId: 274]}
mniykligrnleitdairdyvekklarldryqdgelmakvvlslagkaraeiqvdlpggl
vrveeedadlyaaidravdrletqvkrfr

Timeline for d2ywqb_:

• d2ywqb_ first appeared in SCOP 1.75, called d2ywqb1
  
• d2ywqb_ appears in SCOPe 2.07