Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily) beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest |
Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families) automatically mapped to Pfam PF02482 |
Family d.204.1.1: Ribosome binding protein Y (YfiA homologue) [69755] (2 proteins) |
Protein Ribosome binding protein Y (YfiA homologue) [69756] (3 species) Ribosome associated factor; cold-shock response protein |
Species Thermus thermophilus [TaxId:274] [160457] (1 PDB entry) Uniprot Q5SIS0 1-95 |
Domain d2ywqb_: 2ywq B: [153813] automated match to d2ywqa1 |
PDB Entry: 2ywq (more details), 2.64 Å
SCOPe Domain Sequences for d2ywqb_:
Sequence, based on SEQRES records: (download)
>d2ywqb_ d.204.1.1 (B:) Ribosome binding protein Y (YfiA homologue) {Thermus thermophilus [TaxId: 274]} mniykligrnleitdairdyvekklarldryqdgelmakvvlslagsphvekkaraeiqv dlpgglvrveeedadlyaaidravdrletqvkrfr
>d2ywqb_ d.204.1.1 (B:) Ribosome binding protein Y (YfiA homologue) {Thermus thermophilus [TaxId: 274]} mniykligrnleitdairdyvekklarldryqdgelmakvvlslagkaraeiqvdlpggl vrveeedadlyaaidravdrletqvkrfr
Timeline for d2ywqb_: