Lineage for d2ywqa1 (2ywq A:1-95)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612081Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily)
    beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest
  4. 2612082Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families) (S)
    automatically mapped to Pfam PF02482
  5. 2612083Family d.204.1.1: Ribosome binding protein Y (YfiA homologue) [69755] (2 proteins)
  6. 2612084Protein Ribosome binding protein Y (YfiA homologue) [69756] (3 species)
    Ribosome associated factor; cold-shock response protein
  7. 2612090Species Thermus thermophilus [TaxId:274] [160457] (1 PDB entry)
    Uniprot Q5SIS0 1-95
  8. 2612091Domain d2ywqa1: 2ywq A:1-95 [153812]

Details for d2ywqa1

PDB Entry: 2ywq (more details), 2.64 Å

PDB Description: Crystal structure of Thermus thermophilus Protein Y N-terminal domain
PDB Compounds: (A:) Ribosomal subunit interface protein

SCOPe Domain Sequences for d2ywqa1:

Sequence, based on SEQRES records: (download)

>d2ywqa1 d.204.1.1 (A:1-95) Ribosome binding protein Y (YfiA homologue) {Thermus thermophilus [TaxId: 274]}
mniykligrnleitdairdyvekklarldryqdgelmakvvlslagsphvekkaraeiqv
dlpgglvrveeedadlyaaidravdrletqvkrfr

Sequence, based on observed residues (ATOM records): (download)

>d2ywqa1 d.204.1.1 (A:1-95) Ribosome binding protein Y (YfiA homologue) {Thermus thermophilus [TaxId: 274]}
mniykligrnleitdairdyvekklarldryqdgelmakvvlslagkaraeiqvdlpggl
vrveeedadlyaaidravdrletqvkrfr

SCOPe Domain Coordinates for d2ywqa1:

Click to download the PDB-style file with coordinates for d2ywqa1.
(The format of our PDB-style files is described here.)

Timeline for d2ywqa1: