Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Probable thiol-disulfide isomerase/thioredoxin TTHA0593 [142389] (1 species) |
Species Thermus thermophilus [TaxId:274] [142390] (2 PDB entries) Uniprot Q5SKQ0 2-188 |
Domain d2ywoa_: 2ywo A: [153811] automated match to d2cvba1 |
PDB Entry: 2ywo (more details), 1.9 Å
SCOPe Domain Sequences for d2ywoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ywoa_ c.47.1.10 (A:) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} mlqypelplesplidaelpdprggryrlsqfhepllavvfmcnhcpyvkgsigelvalae ryrgkvafvginandyekypedapekmaafaeehgiffpylldetqevakayralrtpev flfderrllryhgrvndnpkdpskvqshdleaaieallrgeepplkeapaigctikwrpg nepevrig
Timeline for d2ywoa_: