SCOPe 2.05: Domain d2ywoa_: 2ywo A:

Lineage for d2ywoa_ (2ywo A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Probable thiol-disulfide isomerase/thioredoxin TTHA0593 [142389] (1 species)

7. Species Thermus thermophilus [TaxId:274] [142390] (2 PDB entries)
   Uniprot Q5SKQ0 2-188

8. Domain d2ywoa_: 2ywo A: [153811]
   automated match to d2cvba1

Details for d2ywoa_

PDB Entry: 2ywo, 1.9 Å

PDB Description: crystal structure of reduced thioredoxin-like protein from thermus thermophilus hb8

PDB Compounds: (A:) probable thiol-disulfide isomerase/thioredoxin

SCOPe Domain Sequences for d2ywoa_:

Sequence; same for both SEQRES and ATOM records:

>d2ywoa_ c.47.1.10 (A:) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]}
mlqypelplesplidaelpdprggryrlsqfhepllavvfmcnhcpyvkgsigelvalae
ryrgkvafvginandyekypedapekmaafaeehgiffpylldetqevakayralrtpev
flfderrllryhgrvndnpkdpskvqshdleaaieallrgeepplkeapaigctikwrpg
nepevrig

Timeline for d2ywoa_:

• d2ywoa_ first appeared in SCOP 1.75, called d2ywoa1
  
• d2ywoa_ appears in SCOPe 2.04
  
• d2ywoa_ appears in SCOPe 2.06
  
• d2ywoa_ appears in the current release, SCOPe 2.08