| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families) ![]() |
| Family a.24.16.2: Family 1 bi-partite nucleotidyltransferase subunit [81740] (2 proteins) automatically mapped to Pfam PF08780 |
| Protein Probable nucleotidyltransferase subunit TTHA0048 [116876] (1 species) |
| Species Thermus thermophilus [TaxId:274] [116877] (3 PDB entries) Uniprot Q5SM95 Structural genomics target |
| Domain d2ywad1: 2ywa D:2-116 [153810] automatically matched to d1wtya_ |
PDB Entry: 2ywa (more details), 3.2 Å
SCOPe Domain Sequences for d2ywad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ywad1 a.24.16.2 (D:2-116) Probable nucleotidyltransferase subunit TTHA0048 {Thermus thermophilus [TaxId: 274]}
aslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraair
gafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrle
Timeline for d2ywad1: