SCOP 1.75: Domain d2ywac1: 2ywa C:3-116

Lineage for d2ywac1 (2ywa C:3-116)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (4 families)

5. Family a.24.16.2: Family 1 bi-partite nucleotidyltransferase subunit [81740] (2 proteins)

6. Protein Probable nucleotidyltransferase subunit TTHA0048 [116876] (1 species)

7. Species Thermus thermophilus [TaxId:274] [116877] (2 PDB entries)
   Uniprot Q5SM95
   Structural genomics target

8. Domain d2ywac1: 2ywa C:3-116 [153809]
   automatically matched to d1wtya_

Details for d2ywac1

PDB Entry: 2ywa, 3.2 Å

PDB Description: crystal structure of uncharacterized conserved protein from thermus thermophilus hb8

PDB Compounds: (C:) hypothetical protein TTHA0048

SCOP Domain Sequences for d2ywac1:

Sequence; same for both SEQRES and ATOM records:

>d2ywac1 a.24.16.2 (C:3-116) Probable nucleotidyltransferase subunit TTHA0048 {Thermus thermophilus [TaxId: 274]}
slaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraairg
afqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrle

Timeline for d2ywac1:

• d2ywac1 is new in SCOP 1.75
  
• d2ywac1 appears in SCOPe 2.01
  
• d2ywac1 appears in the current release, SCOPe 2.08