Lineage for d1g08a_ (1g08 A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93460Family a.1.1.2: Globins [46463] (18 proteins)
  6. 93559Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 93577Species Cow (Bos taurus) [TaxId:9913] [46490] (5 PDB entries)
  8. 93578Domain d1g08a_: 1g08 A: [15380]
    Other proteins in same PDB: d1g08b_, d1g08d_

Details for d1g08a_

PDB Entry: 1g08 (more details), 1.9 Å

PDB Description: carbonmonoxy liganded bovine hemoglobin ph 5.0

SCOP Domain Sequences for d1g08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g08a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cow (Bos taurus)}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

SCOP Domain Coordinates for d1g08a_:

Click to download the PDB-style file with coordinates for d1g08a_.
(The format of our PDB-style files is described here.)

Timeline for d1g08a_: