Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (9 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (9 proteins) |
Protein Dodecameric ferritin homolog [47250] (13 species) |
Species Mycobacterium smegmatis [TaxId:1772] [109784] (6 PDB entries) Uniprot Q8VP75 |
Domain d2yw6c1: 2yw6 C:17-157 [153796] automatically matched to d1n1qa_ mutant |
PDB Entry: 2yw6 (more details), 2.53 Å
SCOP Domain Sequences for d2yw6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yw6c1 a.25.1.1 (C:17-157) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]} vadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevaeriatlg kspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledldlvsqd lliahagelekfqwfvrahle
Timeline for d2yw6c1: