Lineage for d2yw6c1 (2yw6 C:17-157)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766238Protein Dodecameric ferritin homolog [47250] (13 species)
  7. 766465Species Mycobacterium smegmatis [TaxId:1772] [109784] (6 PDB entries)
    Uniprot Q8VP75
  8. 766468Domain d2yw6c1: 2yw6 C:17-157 [153796]
    automatically matched to d1n1qa_
    mutant

Details for d2yw6c1

PDB Entry: 2yw6 (more details), 2.53 Å

PDB Description: Structural studies of N terminal deletion mutant of Dps from Mycobacterium smegmatis
PDB Compounds: (C:) DNA protection during starvation protein

SCOP Domain Sequences for d2yw6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yw6c1 a.25.1.1 (C:17-157) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]}
vadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevaeriatlg
kspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledldlvsqd
lliahagelekfqwfvrahle

SCOP Domain Coordinates for d2yw6c1:

Click to download the PDB-style file with coordinates for d2yw6c1.
(The format of our PDB-style files is described here.)

Timeline for d2yw6c1: