Lineage for d2yw6b_ (2yw6 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1989902Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1990101Species Mycobacterium smegmatis [TaxId:1772] [109784] (5 PDB entries)
    Uniprot Q8VP75
  8. 1990103Domain d2yw6b_: 2yw6 B: [153795]
    automated match to d1veia_
    mutant

Details for d2yw6b_

PDB Entry: 2yw6 (more details), 2.53 Å

PDB Description: Structural studies of N terminal deletion mutant of Dps from Mycobacterium smegmatis
PDB Compounds: (B:) DNA protection during starvation protein

SCOPe Domain Sequences for d2yw6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yw6b_ a.25.1.1 (B:) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]}
dkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevae
riatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledl
dlvsqdlliahagelekfqwfvrahlesag

SCOPe Domain Coordinates for d2yw6b_:

Click to download the PDB-style file with coordinates for d2yw6b_.
(The format of our PDB-style files is described here.)

Timeline for d2yw6b_: