| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, alpha-chain [46486] (24 species) |
| Species Deer (Odocoileus virginianus) [TaxId:9874] [46489] (1 PDB entry) |
| Domain d1hdsc_: 1hds C: [15379] Other proteins in same PDB: d1hdsb_, d1hdsd_ complexed with hem |
PDB Entry: 1hds (more details), 1.98 Å
SCOPe Domain Sequences for d1hdsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdsc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Deer (Odocoileus virginianus) [TaxId: 9874]}
vlsaanksnvkaawgkvggnapaygaqalqrmflsfpttktyfphfdlshgsaqqkahgq
kvanaltkaqghlndlpgtlsnlsnlhahklrvnpvnfkllshsllvtlashlptnftpa
vhanlnkflandstvltskyr
Timeline for d1hdsc_: