Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (22 species) |
Species Deer (Odocoileus virginianus) [TaxId:9874] [46489] (1 PDB entry) |
Domain d1hdsa_: 1hds A: [15378] Other proteins in same PDB: d1hdsb_, d1hdsd_ complexed with hem |
PDB Entry: 1hds (more details), 1.98 Å
SCOPe Domain Sequences for d1hdsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdsa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Deer (Odocoileus virginianus) [TaxId: 9874]} vlsaanksnvkaawgkvggnapaygaqalqrmflsfpttktyfphfdlshgsaqqkahgq kvanaltkaqghlndlpgtlsnlsnlhahklrvnpvnfkllshsllvtlashlptnftpa vhanlnkflandstvltskyr
Timeline for d1hdsa_: