Lineage for d1hdsa_ (1hds A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93460Family a.1.1.2: Globins [46463] (18 proteins)
  6. 93559Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 93588Species Deer (Odocoileus virginianus) [TaxId:9874] [46489] (1 PDB entry)
  8. 93589Domain d1hdsa_: 1hds A: [15378]
    Other proteins in same PDB: d1hdsb_, d1hdsd_

Details for d1hdsa_

PDB Entry: 1hds (more details), 1.98 Å

PDB Description: macromolecular structure refinement by restrained least-squares and interactive graphics as applied to sickling deer type iii hemoglobin

SCOP Domain Sequences for d1hdsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdsa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Deer (Odocoileus virginianus)}
vlsaanksnvkaawgkvggnapaygaqalqrmflsfpttktyfphfdlshgsaqqkahgq
kvanaltkaqghlndlpgtlsnlsnlhahklrvnpvnfkllshsllvtlashlptnftpa
vhanlnkflandstvltskyr

SCOP Domain Coordinates for d1hdsa_:

Click to download the PDB-style file with coordinates for d1hdsa_.
(The format of our PDB-style files is described here.)

Timeline for d1hdsa_: