Lineage for d2yvta1 (2yvt A:4-260)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998340Family d.159.1.6: TT1561-like [103320] (2 proteins)
    similar to purple acid and protein phosphatases
  6. 2998351Protein Uncharacterized protein Aq_1956 [160870] (1 species)
  7. 2998352Species Aquifex aeolicus [TaxId:63363] [160871] (1 PDB entry)
    Uniprot O67769 4-260
  8. 2998353Domain d2yvta1: 2yvt A:4-260 [153779]

Details for d2yvta1

PDB Entry: 2yvt (more details), 1.6 Å

PDB Description: Crystal structure of aq_1956
PDB Compounds: (A:) Hypothetical protein aq_1956

SCOPe Domain Sequences for d2yvta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]}
mprkvlaiknfkerfdllpklkgviaekqpdilvvvgnilknealekeyerahlarrepn
rkvihenehyiietldkffreigelgvktfvvpgkndaplkiflraayeaetaypnirvl
hegfagwrgefevigfgglltehefeedfvlkyprwyveyilkfvnelkprrlvtifytp
pigefvdrtpedpkhhgsavvntiikslnpevaivghvgkghelvgntivvnpgefeegr
yafldltqhkikleqfs

SCOPe Domain Coordinates for d2yvta1:

Click to download the PDB-style file with coordinates for d2yvta1.
(The format of our PDB-style files is described here.)

Timeline for d2yvta1: