![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.6: TT1561-like [103320] (2 proteins) similar to purple acid and protein phosphatases |
![]() | Protein Uncharacterized protein Aq_1956 [160870] (1 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [160871] (1 PDB entry) Uniprot O67769 4-260 |
![]() | Domain d2yvta1: 2yvt A:4-260 [153779] |
PDB Entry: 2yvt (more details), 1.6 Å
SCOPe Domain Sequences for d2yvta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} mprkvlaiknfkerfdllpklkgviaekqpdilvvvgnilknealekeyerahlarrepn rkvihenehyiietldkffreigelgvktfvvpgkndaplkiflraayeaetaypnirvl hegfagwrgefevigfgglltehefeedfvlkyprwyveyilkfvnelkprrlvtifytp pigefvdrtpedpkhhgsavvntiikslnpevaivghvgkghelvgntivvnpgefeegr yafldltqhkikleqfs
Timeline for d2yvta1: