Lineage for d2ytza_ (2ytz A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130520Family c.66.1.58: TRM1-like [159697] (1 protein)
    Pfam PF02005; contains extra C-terminal alpha+beta subdomain
  6. 2130521Protein N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 [159698] (1 species)
  7. 2130522Species Pyrococcus horikoshii [TaxId:53953] [159699] (4 PDB entries)
    Uniprot O59493 3-377
  8. 2130526Domain d2ytza_: 2ytz A: [153776]
    automated match to d2dula1
    protein/RNA complex; complexed with sah, so4

Details for d2ytza_

PDB Entry: 2ytz (more details), 2.65 Å

PDB Description: Complex structure of Trm1 from Pyrococcus horikoshii with S-adenosyl-L-Homocystein in the orthorhombic crystal-lattice
PDB Compounds: (A:) N(2),N(2)-dimethylguanosine tRNA methyltransferase

SCOPe Domain Sequences for d2ytza_:

Sequence, based on SEQRES records: (download)

>d2ytza_ c.66.1.58 (A:) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]}
elievqegkakilipkaesiydspvfynprmalnrdivvvllnilnpkivldalsatgir
girfaletpaeevwlndisedayelmkrnvmlnfdgelreskgrailkgektivinhdda
nrlmaerhryfhfidldpfgspmefldtalrsakrrgilgvtatdgaplcgahpraclrk
ylavplrgelchevgtrilvgviaryaakydlgidvilayykdhyfrafvklkdgarkgd
etleklgyiyfddktgkfeleqgflptrpnaygpvwlgplkdekivskmvkeaeslslar
kkqalkllkmidqeldiplfydthaigrrlkietkkveeiisalreqgyeatrthfsptg
iktsapyevfietikr

Sequence, based on observed residues (ATOM records): (download)

>d2ytza_ c.66.1.58 (A:) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]}
elievqegkakilipkaesiydspvfynprmalnrdivvvllnilnpkivldalsatgir
girfaletpaeevwlndisedayelmkrnvmlnfdgelreskgrailkgektivinhdda
nrlmaerhryfhfidldpfgspmefldtalrsakrrgilgvtatdgaplcgahpraclrk
ylavplrgelchevgtrilvgviaryaakydlgidvilayykdhyfrafvklkdgarkgd
etleklgyiyfddktgkfeleqgflptrpnaygpvwlgplkdekivskmvkeaeslslar
kkqalkllkmidqeldiplfydthaigrrkkveeiisalreqgyeatrthfsptgiktsa
pyevfietikr

SCOPe Domain Coordinates for d2ytza_:

Click to download the PDB-style file with coordinates for d2ytza_.
(The format of our PDB-style files is described here.)

Timeline for d2ytza_: