SCOPe 2.07: Domain d2mhba_: 2mhb A:

Lineage for d2mhba_ (2mhb A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (24 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46488] (19 PDB entries)

8. Domain d2mhba_: 2mhb A: [15376]
   Other proteins in same PDB: d2mhbb_
   complexed with hem

Details for d2mhba_

PDB Entry: 2mhb, 2 Å

PDB Description: the structure of horse methaemoglobin at 2.0 angstroms resolution

PDB Compounds: (A:) hemoglobin (aquo met) (alpha chain)

SCOPe Domain Sequences for d2mhba_:

Sequence; same for both SEQRES and ATOM records:

>d2mhba_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

Timeline for d2mhba_:

• d2mhba_ first appeared (with stable ids) in SCOP 1.55
  
• d2mhba_ appears in SCOPe 2.06
  
• d2mhba_ appears in the current release, SCOPe 2.08