SCOP 1.59: Domain d2mhba_: 2mhb A:

Lineage for d2mhba_ (2mhb A:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Hemoglobin, alpha-chain [46486] (16 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46488] (4 PDB entries)

8. Domain d2mhba_: 2mhb A: [15376]
   Other proteins in same PDB: d2mhbb_

Details for d2mhba_

PDB Entry: 2mhb, 2 Å

PDB Description: the structure of horse methaemoglobin at 2.0 angstroms resolution

SCOP Domain Sequences for d2mhba_:

Sequence; same for both SEQRES and ATOM records:

>d2mhba_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus)}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

Timeline for d2mhba_:

• d2mhba_ first appeared (with stable ids) in SCOP 1.55
  
• d2mhba_ appears in SCOP 1.57
  
• d2mhba_ appears in SCOP 1.61
  
• d2mhba_ appears in the current release, SCOPe 2.08