Lineage for d2mhba_ (2mhb A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44046Protein Hemoglobin, alpha-chain [46486] (14 species)
  7. 44080Species Horse (Equus caballus) [TaxId:9796] [46488] (4 PDB entries)
  8. 44083Domain d2mhba_: 2mhb A: [15376]
    Other proteins in same PDB: d2mhbb_

Details for d2mhba_

PDB Entry: 2mhb (more details), 2 Å

PDB Description: the structure of horse methaemoglobin at 2.0 angstroms resolution

SCOP Domain Sequences for d2mhba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mhba_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus)}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOP Domain Coordinates for d2mhba_:

Click to download the PDB-style file with coordinates for d2mhba_.
(The format of our PDB-style files is described here.)

Timeline for d2mhba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2mhbb_