Class g: Small proteins [56992] (94 folds) |
Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) |
Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
Protein PATZ1 [161152] (1 species) Zinc finger protein 278 |
Species Human (Homo sapiens) [TaxId:9606] [161153] (5 PDB entries) Uniprot Q9HBE1 286-338! Uniprot Q9HBE1 350-384! Uniprot Q9HBE1 355-379! Uniprot Q9HBE1 380-409! Uniprot Q9HBE1 380-411! Uniprot Q9HBE1 407-445! Uniprot Q9HBE1 410-436 |
Domain d2yt9a3: 2yt9 A:387-416 [153757] Other proteins in same PDB: d2yt9a4, d2yt9a5 complexed with zn |
PDB Entry: 2yt9 (more details)
SCOPe Domain Sequences for d2yt9a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yt9a3 g.37.1.1 (A:387-416) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} ekpyscpvcglrfkrkdrmsyhvrshdgsv
Timeline for d2yt9a3:
View in 3D Domains from same chain: (mouse over for more information) d2yt9a1, d2yt9a2, d2yt9a4, d2yt9a5 |