Lineage for d2yt9a3 (2yt9 A:387-416)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892092Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 892093Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families) (S)
  5. 892094Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins)
  6. 892131Protein PATZ1 [161152] (1 species)
    Zinc finger protein 278
  7. 892132Species Human (Homo sapiens) [TaxId:9606] [161153] (5 PDB entries)
    Uniprot Q9HBE1 286-338! Uniprot Q9HBE1 350-384! Uniprot Q9HBE1 355-379! Uniprot Q9HBE1 380-409! Uniprot Q9HBE1 380-411! Uniprot Q9HBE1 407-445! Uniprot Q9HBE1 410-436
  8. 892139Domain d2yt9a3: 2yt9 A:387-416 [153757]
    complexed with zn

Details for d2yt9a3

PDB Entry: 2yt9 (more details)

PDB Description: solution structure of c2h2 type zinc finger domain 345 in zinc finger protein 278
PDB Compounds: (A:) zinc finger-containing protein 1

SCOP Domain Sequences for d2yt9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yt9a3 g.37.1.1 (A:387-416) PATZ1 {Human (Homo sapiens) [TaxId: 9606]}
ekpyscpvcglrfkrkdrmsyhvrshdgsv

SCOP Domain Coordinates for d2yt9a3:

Click to download the PDB-style file with coordinates for d2yt9a3.
(The format of our PDB-style files is described here.)

Timeline for d2yt9a3: