Lineage for d2yspa1 (2ysp A:8-37)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035159Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 3035382Protein automated matches [192458] (2 species)
    not a true protein
  7. 3035383Species Human (Homo sapiens) [TaxId:9606] [161316] (93 PDB entries)
  8. 3035462Domain d2yspa1: 2ysp A:8-37 [153752]
    Other proteins in same PDB: d2yspa2, d2yspa3
    automatically matched to d1znma_
    complexed with zn

Details for d2yspa1

PDB Entry: 2ysp (more details)

PDB Description: solution structure of the c2h2 type zinc finger (region 507-539) of human zinc finger protein 224
PDB Compounds: (A:) Zinc finger protein 224

SCOPe Domain Sequences for d2yspa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yspa1 g.37.1.1 (A:8-37) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgekpykcekcgkgynskfnldmhqkvhtg

SCOPe Domain Coordinates for d2yspa1:

Click to download the PDB-style file with coordinates for d2yspa1.
(The format of our PDB-style files is described here.)

Timeline for d2yspa1: