Lineage for d2ysia_ (2ysi A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804793Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 1804794Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 1804795Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 1804888Protein automated matches [192459] (3 species)
    not a true protein
  7. 1804912Species Mouse (Mus musculus) [TaxId:10090] [161326] (2 PDB entries)
  8. 1804914Domain d2ysia_: 2ysi A: [153751]
    automated match to d2ysia1

Details for d2ysia_

PDB Entry: 2ysi (more details)

PDB Description: Solution structure of the first WW domain from the mouse transcription elongation regulator 1, transcription factor CA150
PDB Compounds: (A:) Transcription elongation regulator 1

SCOPe Domain Sequences for d2ysia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ysia_ b.72.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgteeiwvenktpdgkvyyynartresawtkpdgv

SCOPe Domain Coordinates for d2ysia_:

Click to download the PDB-style file with coordinates for d2ysia_.
(The format of our PDB-style files is described here.)

Timeline for d2ysia_: