Lineage for d2ysia1 (2ysi A:5-37)

  1. Root: SCOP 1.75
  2. 900990Class k: Designed proteins [58788] (44 folds)
  3. 901446Fold k.22: WW domain-based designs [58912] (1 superfamily)
  4. 901447Superfamily k.22.1: WW domain-based designs [58913] (1 family) (S)
  5. 901448Family k.22.1.1: WW domain-based designs [58914] (2 proteins)
  6. 901452Protein Prototype WW domain [58915] (3 species)
  7. 901455Species Mus musculus [TaxId:10090] [161326] (6 PDB entries)
  8. 901461Domain d2ysia1: 2ysi A:5-37 [153751]
    automatically matched to d1e0ma_

Details for d2ysia1

PDB Entry: 2ysi (more details)

PDB Description: Solution structure of the first WW domain from the mouse transcription elongation regulator 1, transcription factor CA150
PDB Compounds: (A:) Transcription elongation regulator 1

SCOP Domain Sequences for d2ysia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ysia1 k.22.1.1 (A:5-37) Prototype WW domain {Mus musculus [TaxId: 10090]}
ssgteeiwvenktpdgkvyyynartresawtkp

SCOP Domain Coordinates for d2ysia1:

Click to download the PDB-style file with coordinates for d2ysia1.
(The format of our PDB-style files is described here.)

Timeline for d2ysia1: