Lineage for d2ysga1 (2ysg A:5-40)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1136466Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 1136467Superfamily b.72.1: WW domain [51045] (1 family) (S)
  5. 1136468Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 1136537Protein automated matches [192459] (2 species)
    not a true protein
  7. 1136538Species Human (Homo sapiens) [TaxId:9606] [161325] (5 PDB entries)
  8. 1136540Domain d2ysga1: 2ysg A:5-40 [153749]
    automatically matched to d1e0ma_

Details for d2ysga1

PDB Entry: 2ysg (more details)

PDB Description: solution structure of the ww domain from the human syntaxin-binding protein 4
PDB Compounds: (A:) Syntaxin-binding protein 4

SCOPe Domain Sequences for d2ysga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ysga1 b.72.1.1 (A:5-40) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssglpygweeaytadgikyfinhvtqttswihpvms

SCOPe Domain Coordinates for d2ysga1:

Click to download the PDB-style file with coordinates for d2ysga1.
(The format of our PDB-style files is described here.)

Timeline for d2ysga1: