SCOPe 2.08: Domain d2ysga2: 2ysg A:8-40

Lineage for d2ysga2 (2ysg A:8-40)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.1: WW domain [51045] (2 families)

5. Family b.72.1.1: WW domain [51046] (13 proteins)

6. Protein automated matches [192459] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [161325] (20 PDB entries)

8. Domain d2ysga2: 2ysg A:8-40 [153749]
   Other proteins in same PDB: d2ysga3
   automated match to d2ysga1

Details for d2ysga2

PDB Entry: 2ysg

PDB Description: solution structure of the ww domain from the human syntaxin-binding protein 4

PDB Compounds: (A:) Syntaxin-binding protein 4

SCOPe Domain Sequences for d2ysga2:

Sequence; same for both SEQRES and ATOM records:

>d2ysga2 b.72.1.1 (A:8-40) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpygweeaytadgikyfinhvtqttswihpvms

Timeline for d2ysga2:

• d2ysga2 first appeared in SCOP 1.75, called d2ysga1
  
• d2ysga2 appears in SCOPe 2.07