Class b: All beta proteins [48724] (174 folds) |
Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.1: WW domain [51045] (1 family) |
Family b.72.1.1: WW domain [51046] (13 proteins) |
Protein automated matches [192459] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [161325] (5 PDB entries) |
Domain d2ysfa1: 2ysf A:5-38 [153748] automatically matched to d1e0ma_ |
PDB Entry: 2ysf (more details)
SCOPe Domain Sequences for d2ysfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ysfa1 b.72.1.1 (A:5-38) automated matches {Human (Homo sapiens) [TaxId: 9606]} ssglpegwemrftvdgipyfvdhnrrtttyidpr
Timeline for d2ysfa1: