Lineage for d2ysfa1 (2ysf A:5-38)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1136466Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 1136467Superfamily b.72.1: WW domain [51045] (1 family) (S)
  5. 1136468Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 1136537Protein automated matches [192459] (2 species)
    not a true protein
  7. 1136538Species Human (Homo sapiens) [TaxId:9606] [161325] (5 PDB entries)
  8. 1136539Domain d2ysfa1: 2ysf A:5-38 [153748]
    automatically matched to d1e0ma_

Details for d2ysfa1

PDB Entry: 2ysf (more details)

PDB Description: solution structure of the fourth ww domain from the human e3 ubiquitin-protein ligase itchy homolog, itch
PDB Compounds: (A:) E3 ubiquitin-protein ligase Itchy homolog

SCOPe Domain Sequences for d2ysfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ysfa1 b.72.1.1 (A:5-38) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssglpegwemrftvdgipyfvdhnrrtttyidpr

SCOPe Domain Coordinates for d2ysfa1:

Click to download the PDB-style file with coordinates for d2ysfa1.
(The format of our PDB-style files is described here.)

Timeline for d2ysfa1: