SCOP 1.75: Domain d2yrka1: 2yrk A:8-55

Lineage for d2yrka1 (2yrk A:8-55)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families)

5. Family g.37.1.4: HkH motif-containing C2H2 finger [111436] (4 proteins)
   putative dsRNA-specific zinc finger with a helix-kink-helix (HkH) motif; the kink results from the incompatibility of the cation-coordinating H-x5-H motif with a regular alpha-helix and contributes to RNA recognition

6. Protein Zinc finger homeobox protein 4, ZFHX4 [161156] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161157] (1 PDB entry)
   Uniprot Q9JJN9 2937-2984

8. Domain d2yrka1: 2yrk A:8-55 [153744]
   complexed with zn

Details for d2yrka1

PDB Entry: 2yrk

PDB Description: solution structure of the zf-c2h2 domain in zinc finger homeodomain 4

PDB Compounds: (A:) Zinc finger homeobox protein 4

SCOP Domain Sequences for d2yrka1:

Sequence; same for both SEQRES and ATOM records:

>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]}
gtdgtkpectlcgvkysarlsirdhifskqhiskvretvgsqldrekd

Timeline for d2yrka1:

• d2yrka1 is new in SCOP 1.75
  
• d2yrka1 appears in SCOPe 2.01
  
• d2yrka1 appears in the current release, SCOPe 2.08