![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
![]() | Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
![]() | Family g.37.1.4: HkH motif-containing C2H2 finger [111436] (4 proteins) putative dsRNA-specific zinc finger with a helix-kink-helix (HkH) motif; the kink results from the incompatibility of the cation-coordinating H-x5-H motif with a regular alpha-helix and contributes to RNA recognition |
![]() | Protein Zinc finger homeobox protein 4, ZFHX4 [161156] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [161157] (1 PDB entry) Uniprot Q9JJN9 2937-2984 |
![]() | Domain d2yrka1: 2yrk A:8-55 [153744] Other proteins in same PDB: d2yrka2 complexed with zn |
PDB Entry: 2yrk (more details)
SCOPe Domain Sequences for d2yrka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} gtdgtkpectlcgvkysarlsirdhifskqhiskvretvgsqldrekd
Timeline for d2yrka1: