Lineage for d2yrba1 (2yrb A:595-737)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772796Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 2772813Protein Fantom [158942] (1 species)
    RPGR-interacting protein 1-like protein
  7. 2772814Species Human (Homo sapiens) [TaxId:9606] [158943] (1 PDB entry)
    Uniprot Q68CZ1 596-737
  8. 2772815Domain d2yrba1: 2yrb A:595-737 [153741]
    Other proteins in same PDB: d2yrba2, d2yrba3
    1st C2 domain

Details for d2yrba1

PDB Entry: 2yrb (more details)

PDB Description: solution structure of the first c2 domain from human kiaa1005 protein
PDB Compounds: (A:) Protein fantom

SCOPe Domain Sequences for d2yrba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yrba1 b.7.1.1 (A:595-737) Fantom {Human (Homo sapiens) [TaxId: 9606]}
detihlergenlfeihinkvtfssevlqasgdkepvtfctyafydfelqttpvvrglhpe
ynftsqylvhvndlflqyiqkntitlevhqaysteyetiaacqlkfheileksgrifcta
sligtkgdipnfgtveywfrlrv

SCOPe Domain Coordinates for d2yrba1:

Click to download the PDB-style file with coordinates for d2yrba1.
(The format of our PDB-style files is described here.)

Timeline for d2yrba1: