Lineage for d2vzsb5 (2vzs B:336-674)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1145755Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1146070Protein Exochitosanase CsxA [159383] (1 species)
  7. 1146071Species Amycolatopsis orientalis [TaxId:31958] [159384] (1 PDB entry)
    Uniprot Q56F26 336-674
  8. 1146073Domain d2vzsb5: 2vzs B:336-674 [153736]
    Other proteins in same PDB: d2vzsa1, d2vzsa2, d2vzsa3, d2vzsa4, d2vzsb1, d2vzsb2, d2vzsb3, d2vzsb4
    automatically matched to 2VZS A:336-674
    complexed with cd, gcs, gol

Details for d2vzsb5

PDB Entry: 2vzs (more details), 1.85 Å

PDB Description: chitosan product complex of amycolatopsis orientalis exo-chitosanase csxa
PDB Compounds: (B:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2vzsb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzsb5 c.1.8.3 (B:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]}
dvkatlnssggrqysvngkpllirgggytpdlflrwnetaaadklkyvlnlglntvrleg
hiepdeffdiaddlgvltmpgweccdkwegqvngeekgepwvesdypiakasmfseaerl
rdhpsvisfhigsdfapdrrieqgyldamkaadfllpvipaasarpspitgasgmkmngp
ydyvppvywydksqkdrggawsfnsetsagvdiptmdtlkrmmsaseldtmwknpsakqy
hrsssdtfgnlklfgdaltkrygasanlndfvrkaqlsqyenvraefeshsrnytdstnp
stgliywmlnspwtslhwqlfdaymdqngayygakkane

SCOPe Domain Coordinates for d2vzsb5:

Click to download the PDB-style file with coordinates for d2vzsb5.
(The format of our PDB-style files is described here.)

Timeline for d2vzsb5: