Lineage for d2vzsb4 (2vzs B:42-225)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 942101Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 942102Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 942205Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 942371Protein Exochitosanase CsxA [158961] (1 species)
  7. 942372Species Amycolatopsis orientalis [TaxId:31958] [158962] (1 PDB entry)
    Uniprot Q56F26 42-225
  8. 942374Domain d2vzsb4: 2vzs B:42-225 [153735]
    Other proteins in same PDB: d2vzsa1, d2vzsa2, d2vzsa3, d2vzsa5, d2vzsb1, d2vzsb2, d2vzsb3, d2vzsb5
    automatically matched to 2VZS A:42-225
    complexed with cd, gcs, gol

Details for d2vzsb4

PDB Entry: 2vzs (more details), 1.85 Å

PDB Description: chitosan product complex of amycolatopsis orientalis exo-chitosanase csxa
PDB Compounds: (B:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2vzsb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzsb4 b.18.1.5 (B:42-225) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]}
lsvgaaagnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkya
dpfystnmqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdq
vngaytrhdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlv
rrsg

SCOPe Domain Coordinates for d2vzsb4:

Click to download the PDB-style file with coordinates for d2vzsb4.
(The format of our PDB-style files is described here.)

Timeline for d2vzsb4: