![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families) ![]() |
![]() | Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
![]() | Protein Exochitosanase CsxA [158961] (1 species) |
![]() | Species Amycolatopsis orientalis [TaxId:31958] [158962] (1 PDB entry) Uniprot Q56F26 42-225 |
![]() | Domain d2vzsa4: 2vzs A:42-225 [153730] Other proteins in same PDB: d2vzsa1, d2vzsa2, d2vzsa3, d2vzsa5, d2vzsb1, d2vzsb2, d2vzsb3, d2vzsb5 complexed with cd, gcs, gol |
PDB Entry: 2vzs (more details), 1.85 Å
SCOP Domain Sequences for d2vzsa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vzsa4 b.18.1.5 (A:42-225) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} lsvgaaagnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkya dpfystnmqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdq vngaytrhdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlv rrsg
Timeline for d2vzsa4: