Lineage for d2vzsa1 (2vzs A:226-335)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1110264Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 1110265Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1110605Protein Exochitosanase CsxA, domains 2, 4 and 5 [158903] (1 species)
  7. 1110606Species Amycolatopsis orientalis [TaxId:31958] [158904] (1 PDB entry)
    Uniprot Q56F26 226-335! Uniprot Q56F26 675-777! Uniprot Q56F26 778-899
  8. 1110607Domain d2vzsa1: 2vzs A:226-335 [153727]
    Other proteins in same PDB: d2vzsa4, d2vzsa5, d2vzsb4, d2vzsb5
    complexed with cd, gcs, gol

Details for d2vzsa1

PDB Entry: 2vzs (more details), 1.85 Å

PDB Description: chitosan product complex of amycolatopsis orientalis exo-chitosanase csxa
PDB Compounds: (A:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2vzsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vzsa1 b.1.4.1 (A:226-335) Exochitosanase CsxA, domains 2, 4 and 5 {Amycolatopsis orientalis [TaxId: 31958]}
avalrsahviqklnsaldhadltvkadvrndsanavqttvagtvagkpisqtvslaaker
ktvtfplvgldrpnvwwpagmggqhrydldltasvggtpsdaakskfgvr

SCOPe Domain Coordinates for d2vzsa1:

Click to download the PDB-style file with coordinates for d2vzsa1.
(The format of our PDB-style files is described here.)

Timeline for d2vzsa1: