Lineage for d2vz3a1 (2vz3 A:538-639)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789056Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 789176Protein Galactose oxidase, C-terminal domain [49209] (3 species)
    follows the catalytic seven-bladed beta-propeller domain
  7. 789188Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [158881] (3 PDB entries)
  8. 789190Domain d2vz3a1: 2vz3 A:538-639 [153724]
    Other proteins in same PDB: d2vz3a2, d2vz3a3
    automatically matched to d1gofa1
    complexed with act, cu

Details for d2vz3a1

PDB Entry: 2vz3 (more details), 1.9 Å

PDB Description: bleached galactose oxidase
PDB Compounds: (A:) Galactose oxidase

SCOP Domain Sequences for d2vz3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vz3a1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

SCOP Domain Coordinates for d2vz3a1:

Click to download the PDB-style file with coordinates for d2vz3a1.
(The format of our PDB-style files is described here.)

Timeline for d2vz3a1: