Lineage for d2vz1a3 (2vz1 A:151-537)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418202Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families) (S)
  5. 2418203Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins)
  6. 2418204Protein Galactose oxidase, central domain [50967] (3 species)
    N-terminal domain is a jelly-roll sandwich
    C-terminal domain is Immunoglobulin-like
  7. 2418212Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [159255] (6 PDB entries)
  8. 2418216Domain d2vz1a3: 2vz1 A:151-537 [153723]
    Other proteins in same PDB: d2vz1a1, d2vz1a2
    automated match to d1gofa3
    complexed with act, ca

Details for d2vz1a3

PDB Entry: 2vz1 (more details), 1.91 Å

PDB Description: premat-galactose oxidase
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2vz1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vz1a3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

SCOPe Domain Coordinates for d2vz1a3:

Click to download the PDB-style file with coordinates for d2vz1a3.
(The format of our PDB-style files is described here.)

Timeline for d2vz1a3: