SCOP 1.75: Domain d2vz1a3: 2vz1 A:151-537

Lineage for d2vz1a3 (2vz1 A:151-537)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.1: Galactose oxidase, central domain [50965] (1 family)

5. Family b.69.1.1: Galactose oxidase, central domain [50966] (1 protein)

6. Protein Galactose oxidase, central domain [50967] (3 species)
   N-terminal domain is a jelly-roll sandwich
   C-terminal domain is Immunoglobulin-like

7. Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [159255] (3 PDB entries)

8. Domain d2vz1a3: 2vz1 A:151-537 [153723]
   Other proteins in same PDB: d2vz1a1, d2vz1a2
   automatically matched to d1gofa3
   complexed with act, ca

Details for d2vz1a3

PDB Entry: 2vz1, 1.91 Å

PDB Description: premat-galactose oxidase

PDB Compounds: (A:) Galactose oxidase

SCOP Domain Sequences for d2vz1a3:

Sequence; same for both SEQRES and ATOM records:

>d2vz1a3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

Timeline for d2vz1a3:

• d2vz1a3 is new in SCOP 1.75
  
• d2vz1a3 appears in SCOPe 2.01
  
• d2vz1a3 appears in the current release, SCOPe 2.08