![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Galactose oxidase, C-terminal domain [49209] (3 species) follows the catalytic seven-bladed beta-propeller domain |
![]() | Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [158881] (6 PDB entries) |
![]() | Domain d2vz1a1: 2vz1 A:538-639 [153721] Other proteins in same PDB: d2vz1a2, d2vz1a3 automated match to d1gofa1 complexed with act, ca |
PDB Entry: 2vz1 (more details), 1.91 Å
SCOPe Domain Sequences for d2vz1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vz1a1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]} gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq
Timeline for d2vz1a1: