Lineage for d2vyvc1 (2vyv C:0-147,C:312-329)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 820760Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 820964Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 821033Species Escherichia coli [TaxId:562] [51802] (9 PDB entries)
    Uniprot P06977
  8. 821044Domain d2vyvc1: 2vyv C:0-147,C:312-329 [153719]
    Other proteins in same PDB: d2vyva2, d2vyvb2, d2vyvc2
    automatically matched to d1dc3a1
    complexed with 1gp, fmt, nad

Details for d2vyvc1

PDB Entry: 2vyv (more details), 2.38 Å

PDB Description: structure of e.coli gapdh rat sperm gapdh heterotetramer
PDB Compounds: (C:) glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d2vyvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vyvc1 c.2.1.3 (C:0-147,C:312-329) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnasXnetgysnkvldliahisk

SCOP Domain Coordinates for d2vyvc1:

Click to download the PDB-style file with coordinates for d2vyvc1.
(The format of our PDB-style files is described here.)

Timeline for d2vyvc1: