| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
| Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species) |
| Species Escherichia coli [TaxId:562] [51802] (12 PDB entries) Uniprot P06977 |
| Domain d2vyvb1: 2vyv B:0-146,B:311-329 [153717] Other proteins in same PDB: d2vyva2, d2vyvb2, d2vyvc2 automated match to d1s7ca1 complexed with 1gp, fmt, nad |
PDB Entry: 2vyv (more details), 2.38 Å
SCOPe Domain Sequences for d2vyvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vyvb1 c.2.1.3 (B:0-146,B:311-329) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnaXdnetgysnkvldliahisk
Timeline for d2vyvb1:
View in 3DDomains from other chains: (mouse over for more information) d2vyva1, d2vyva2, d2vyvc1, d2vyvc2 |