SCOP 1.75: Domain d2vyva2: 2vyv A:149-311

Lineage for d2vyva2 (2vyv A:149-311)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species Escherichia coli [TaxId:562] [55350] (9 PDB entries)
   Uniprot P06977

8. Domain d2vyva2: 2vyv A:149-311 [153716]
   Other proteins in same PDB: d2vyva1, d2vyvb1, d2vyvc1
   automatically matched to d1dc3a2
   complexed with 1gp, fmt, nad

Details for d2vyva2

PDB Entry: 2vyv, 2.38 Å

PDB Description: structure of e.coli gapdh rat sperm gapdh heterotetramer

PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d2vyva2:

Sequence; same for both SEQRES and ATOM records:

>d2vyva2 d.81.1.1 (A:149-311) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
ttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipsstg
aakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegemkg
vlgyteddvvstdfngevctsvfdakagialndnfvklvswyd

Timeline for d2vyva2:

• d2vyva2 is new in SCOP 1.75
  
• d2vyva2 appears in SCOPe 2.01
  
• d2vyva2 appears in the current release, SCOPe 2.08