Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (20 species) |
Species Escherichia coli [TaxId:562] [51802] (9 PDB entries) Uniprot P06977 |
Domain d2vync1: 2vyn C:0-146,C:311-329 [153711] Other proteins in same PDB: d2vyna2, d2vynb2, d2vync2 automated match to d1s7ca1 complexed with fmt, nad |
PDB Entry: 2vyn (more details), 2.2 Å
SCOPe Domain Sequences for d2vync1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vync1 c.2.1.3 (C:0-146,C:311-329) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg pskdntpmfvkganfdkyagqdivsnaXdnetgysnkvldliahisk
Timeline for d2vync1:
View in 3D Domains from other chains: (mouse over for more information) d2vyna1, d2vyna2, d2vynb1, d2vynb2 |