Lineage for d2vynb2 (2vyn B:149-311)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1033075Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1033076Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1033077Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1033131Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1033187Species Escherichia coli [TaxId:562] [55350] (9 PDB entries)
    Uniprot P06977
  8. 1033191Domain d2vynb2: 2vyn B:149-311 [153710]
    Other proteins in same PDB: d2vyna1, d2vynb1, d2vync1
    automatically matched to d1dc3a2
    complexed with fmt, nad

Details for d2vynb2

PDB Entry: 2vyn (more details), 2.2 Å

PDB Description: structure of e.coli gapdh rat sperm gapdh heterotetramer
PDB Compounds: (B:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2vynb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vynb2 d.81.1.1 (B:149-311) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
ttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipsstg
aakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegemkg
vlgyteddvvstdfngevctsvfdakagialndnfvklvswyd

SCOPe Domain Coordinates for d2vynb2:

Click to download the PDB-style file with coordinates for d2vynb2.
(The format of our PDB-style files is described here.)

Timeline for d2vynb2: