SCOPe 2.05: Domain d2vynb1: 2vyn B:0-146,B:311-329

Lineage for d2vynb1 (2vyn B:0-146,B:311-329)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species Escherichia coli [TaxId:562] [51802] (9 PDB entries)
   Uniprot P06977

8. Domain d2vynb1: 2vyn B:0-146,B:311-329 [153709]
   Other proteins in same PDB: d2vyna2, d2vynb2, d2vync2
   automated match to d1s7ca1
   complexed with fmt, nad

Details for d2vynb1

PDB Entry: 2vyn, 2.2 Å

PDB Description: structure of e.coli gapdh rat sperm gapdh heterotetramer

PDB Compounds: (B:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2vynb1:

Sequence; same for both SEQRES and ATOM records:

>d2vynb1 c.2.1.3 (B:0-146,B:311-329) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnaXdnetgysnkvldliahisk

Timeline for d2vynb1:

• d2vynb1 first appeared in SCOP 1.75
  
• d2vynb1 appears in SCOPe 2.04
  
• d2vynb1 appears in SCOPe 2.06
  
• d2vynb1 appears in the current release, SCOPe 2.08