Lineage for d2vyna2 (2vyn A:147-310)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203127Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2203128Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2203219Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (20 species)
  7. 2203275Species Escherichia coli [TaxId:562] [55350] (9 PDB entries)
    Uniprot P06977
  8. 2203278Domain d2vyna2: 2vyn A:147-310 [153708]
    Other proteins in same PDB: d2vyna1, d2vynb1, d2vync1
    automated match to d1s7ca2
    complexed with fmt, nad

Details for d2vyna2

PDB Entry: 2vyn (more details), 2.2 Å

PDB Description: structure of e.coli gapdh rat sperm gapdh heterotetramer
PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2vyna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vyna2 d.81.1.1 (A:147-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
scttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipss
tgaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegem
kgvlgyteddvvstdfngevctsvfdakagialndnfvklvswy

SCOPe Domain Coordinates for d2vyna2:

Click to download the PDB-style file with coordinates for d2vyna2.
(The format of our PDB-style files is described here.)

Timeline for d2vyna2: