Lineage for d2vyna1 (2vyn A:0-146,A:311-329)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2104791Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2105032Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (20 species)
  7. 2105088Species Escherichia coli [TaxId:562] [51802] (9 PDB entries)
    Uniprot P06977
  8. 2105091Domain d2vyna1: 2vyn A:0-146,A:311-329 [153707]
    Other proteins in same PDB: d2vyna2, d2vynb2, d2vync2
    automated match to d1s7ca1
    complexed with fmt, nad

Details for d2vyna1

PDB Entry: 2vyn (more details), 2.2 Å

PDB Description: structure of e.coli gapdh rat sperm gapdh heterotetramer
PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2vyna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vyna1 c.2.1.3 (A:0-146,A:311-329) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnaXdnetgysnkvldliahisk

SCOPe Domain Coordinates for d2vyna1:

Click to download the PDB-style file with coordinates for d2vyna1.
(The format of our PDB-style files is described here.)

Timeline for d2vyna1: