Lineage for d2vyia_ (2vyi A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2333769Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 protein domains)
  6. 2333906Protein automated matches [190103] (4 species)
    not a true protein
  7. 2333911Species Human (Homo sapiens) [TaxId:9606] [186825] (11 PDB entries)
  8. 2333913Domain d2vyia_: 2vyi A: [153706]
    automated match to d2vyib_

Details for d2vyia_

PDB Entry: 2vyi (more details), 2.4 Å

PDB Description: crystal structure of the tpr domain of human sgt
PDB Compounds: (A:) sgta protein

SCOPe Domain Sequences for d2vyia_:

Sequence, based on SEQRES records: (download)

>d2vyia_ a.118.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gplgseedsaeaerlktegneqmkvenfeaavhfygkaielnpanavyfcnraaaysklg
nyagavqdceraicidpayskaygrmglalsslnkhveavayykkaleldpdnetyksnl
kiaelklreap

Sequence, based on observed residues (ATOM records): (download)

>d2vyia_ a.118.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpledsaeaerlktegneqmkvenfeaavhfygkaielnpanavyfcnraaaysklgnya
gavqdceraicidpayskaygrmglalsslnkhveavayykkaleldpdnetyksnlkia
elklreap

SCOPe Domain Coordinates for d2vyia_:

Click to download the PDB-style file with coordinates for d2vyia_.
(The format of our PDB-style files is described here.)

Timeline for d2vyia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2vyib_