Lineage for d2vyia_ (2vyi A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726650Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2726794Protein automated matches [190103] (5 species)
    not a true protein
  7. 2726805Species Human (Homo sapiens) [TaxId:9606] [186825] (13 PDB entries)
  8. 2726807Domain d2vyia_: 2vyi A: [153706]
    automated match to d2vyib_

Details for d2vyia_

PDB Entry: 2vyi (more details), 2.4 Å

PDB Description: crystal structure of the tpr domain of human sgt
PDB Compounds: (A:) sgta protein

SCOPe Domain Sequences for d2vyia_:

Sequence, based on SEQRES records: (download)

>d2vyia_ a.118.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gplgseedsaeaerlktegneqmkvenfeaavhfygkaielnpanavyfcnraaaysklg
nyagavqdceraicidpayskaygrmglalsslnkhveavayykkaleldpdnetyksnl
kiaelklreap

Sequence, based on observed residues (ATOM records): (download)

>d2vyia_ a.118.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpledsaeaerlktegneqmkvenfeaavhfygkaielnpanavyfcnraaaysklgnya
gavqdceraicidpayskaygrmglalsslnkhveavayykkaleldpdnetyksnlkia
elklreap

SCOPe Domain Coordinates for d2vyia_:

Click to download the PDB-style file with coordinates for d2vyia_.
(The format of our PDB-style files is described here.)

Timeline for d2vyia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2vyib_