SCOP 1.75: Domain d2vy5a1: 2vy5 A:53-87

Lineage for d2vy5a1 (2vy5 A:53-87)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families)

5. Family g.37.1.7: CHHC finger [161158] (1 protein)

6. Protein U11/U12 small nuclear ribonucleoprotein 48 kDa protein, U11-48K [161159] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161160] (2 PDB entries)
   Uniprot Q6IEG0 53-87

8. Domain d2vy5a1: 2vy5 A:53-87 [153705]
   complexed with zn

Details for d2vy5a1

PDB Entry: 2vy5

PDB Description: u11-48k chhc zn-finger protein domain

PDB Compounds: (A:) u11/u12 small nuclear ribonucleoprotein 48 kda protein

SCOP Domain Sequences for d2vy5a1:

Sequence; same for both SEQRES and ATOM records:

>d2vy5a1 g.37.1.7 (A:53-87) U11/U12 small nuclear ribonucleoprotein 48 kDa protein, U11-48K {Human (Homo sapiens) [TaxId: 9606]}
devvicpydsnhhmpksslakhmascrlrkmgytk

Timeline for d2vy5a1:

• d2vy5a1 is new in SCOP 1.75
  
• d2vy5a1 appears in SCOPe 2.01
  
• d2vy5a1 appears in the current release, SCOPe 2.08